PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G1324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 194aa    MW: 22260.1 Da    PI: 6.5106
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G1324genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.73.3e-1582131554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L+++l++ ++
  Gh_D02G1324  82 RKQRRMISNRESARRSRMRKQKHLDELWSQVIRLRNENHSLIDKLNHVSE 131
                  79*******************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-1678142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.65780131IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.57E-1382131No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-1382155No hitNo description
PfamPF001709.8E-1382131IPR004827Basic-leucine zipper domain
CDDcd147023.14E-2083134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAPGELAGLH YLAPENPILN PANLGMMQNT IPAFHFNRFL NSLPNFNILP PAHEFTAQSS  60
SISNYSTSDE AEEHQVNIID ERKQRRMISN RESARRSRMR KQKHLDELWS QVIRLRNENH  120
SLIDKLNHVS ECHDLVLQEN AKLKEEASDL RQMLTDLKIG SPYLKELEEV PCNTAHLRAE  180
STNQSIANSV DFLH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478829.11e-142PREDICTED: basic leucine zipper 43
SwissprotQ9FMC21e-36BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0D2RFH81e-142A0A0D2RFH8_G
STRINGVIT_01s0010g00930.t014e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.17e-48basic leucine-zipper 58